Derniers Plans:
RSS
Feb 24
C.116-Bénéfices de l'utilisation du ginseng rouge coréen chez les patients HIV+ PDF Imprimer Envoyer
Écrit par Hyeyoung Min   
Samedi, 23 Décembre 2017 16:42

La médecine occidentale, en raison de son arrogance et de sa conviction de supériorité, ignore et dénigre  les apports des  médecines traditionnelles. Nous publions ci dessous un article  montrant l'intérêt du ginseng rouge coréen pour lequel il a été établi une activité  antivirale contre le HIV , mais également contre de nombreux virus, auquels le seropositif est sensible(infections opportunistes). Enfin, le ginseng rouge retarde les mutations du virus qui peuvent conduire à la resistance aux antiviraux. Nous avions déjà signalé (http://www.positifs.org/fr/publications/our-publications/128-c39-interet-de-lutilisation-dantimutagenes.html) le caractère anti-mutagène du ginseng rouge. Il serait hautement souhaitable que le ginseng rouge soit prescrit systématiquement aux séropositifs.

 

J Ginseng Res. 2016 Oct; 40(4): 309–314.

Ginseng, the natural effectual antiviral: Protective effects of Korean Red Ginseng against viral infection

Abstract

Korean Red Ginseng (KRG) is a heat-processed ginseng developed by the repeated steaming and air-drying of fresh ginseng. Compared with fresh ginseng, KRG has been shown to possess greater pharmacological activities and stability because of changes that occur in its chemical constituents during the steaming process. In addition to anticancer, anti-inflammatory, and immune-modulatory activities, KRG and its purified components have also been shown to possess protective effects against microbial infections. Here, we summarize the current knowledge on the properties of KRG and its components on infections with human pathogenic viruses such as respiratory syncytial virus, rhinovirus, influenza virus, human immunodeficiency virus, human herpes virus, hepatitis virus, norovirus, rotavirus, enterovirus, and coxsackievirus. Additionally, the therapeutic potential of KRG as an antiviral and vaccine adjuvant is discussed.

Keywords: antiviral, ginsenosides, hepatitis virus, influenza virus, Korean Red Ginseng

1. Introduction

Viruses are infective obligate parasites that can replicate only in the living cells of animals, plants, fungi, or bacteria. Although extremely small in size and simple in structure, viruses cause numerous diseases such as cancer, autoimmune disease, and immunodeficiency as well as organ-specific infectious diseases including the common cold, influenza, diarrhea, hepatitis, etc. [1], [2], [3], [4].

Recent progress in the formulation of antiviral therapies and vaccines has helped to prevent, shorten the duration, or decrease the severity of viral infection [5], [6], [7]. Most antiviral agents are designed to target viral components, but mutations in the viral genome often result in drug resistance and immune evasion, creating a major hurdle for antiviral therapies and vaccine development [8]. In addition, the continuous emergence of new infectious agents such as the Ebola virus and Middle East respiratory syndrome coronavirus (MERS-CoV) necessitate the advancement of novel therapeutic approaches. Accordingly, great attention has recently been drawn to the development of antivirals with broad-spectrum efficacy and immunomodulators which improve host resilience by increasing host resistance to the viral infection [9].

Korean ginseng (the root of Panax ginseng Meyer) is one of the most popular medicinal plants used in traditional medicine in East Asian countries including Korea [10]. Ginseng contains various pharmacologically active substances such as ginsenosides, polysaccharides, polyacetylenes, phytosterols, and essential oils, and among those, ginsenosides are considered the major bioactive compounds [11]. Korean Red Ginseng (KRG) is a heat-processed ginseng which is prepared by the repeated process of steaming and air-drying fresh ginseng [12]. KRG has been shown to possess enhanced pharmacological activities and stability compared with fresh ginseng because of changes in its chemical constituents such as ginsenosides Rg2, Rg3 Rh1, and Rh2, which occur during the steaming process [13].

Currently, numerous studies have reported the beneficial effects of KRG on diverse diseases such as cancer, immune system disorder, neuronal disease, and cardiovascular disease [14], [15], [16], [17]. In addition, KRG and its purified components have also been shown to possess protective activities against microbial infections [18]. In this review, we summarize the current knowledge on the effects of KRG and its components on infections with human pathogenic viruses and discuss the therapeutic potential of KRG as an antiviral and vaccine adjuvant.

2. Respiratory syncytial virus

Respiratory syncytial virus (RSV) is the leading cause of lower respiratory tract infection. This viral infection shows mild and indistinguishable symptoms from common colds in adults and healthy children but can also cause severe lower respiratory tract diseases such as pneumonia and bronchiolitis in premature babies and infants with underlying health conditions and immunocompromised patients. No effective antiviral therapy or preventive vaccine in early life is currently available, but maternal vaccination is considered a possible strategy to provide RSV antibody protection to young infants [1].

The Kang Laboratory (Georgia State University, GA) has published several studies on the immunomodulatory and antiviral effects of KRG extract (RGE) on RSV [19], [20], [21]. Although a formalin-inactivated RSV (FI-RSV) vaccine was developed in the 1960s, immunization with FI-RSV was halted because vaccinated children experienced severe respiratory disease during the natural RSV infection. The severe form of the disease caused by the FI-RSV has been attributed to the strong T-helper type 2 (Th2) immune response, and RGE has been shown to mitigate such Th2 responses by enhancing the T-helper type 1 (Th1) response in F1-RSV immunized mice which have Th2-dominant immune response intrinsically [19]. Thus, RGE-treated mice that were immunized with FI-RSV showed improved clinical outcomes via an increase in the immunoglobulin G2a (IgG2a) antibodies level and interferon (IFN)-γ production accompanied by a decrease in IL-4 production and weight loss after RSV infection [19]. The data indicate that RGE possesses an immunomodulatory effect by balancing Th1 and Th2 immune responses, and protects the host from severe pulmonary inflammation upon FI-RSV immunization and RSV infection.

In addition, RGE protected human epithelial cells from RSV-induced cell death and viral replication and inhibited the production of proinflammatory cytokines in vitro upon RSV infection [20], [21]. Moreover, RGE treatment improved clinical outcomes by preventing weight loss and increasing viral clearance and IFN-γ production in bronchoalveolar lavage cells in mice [20], [21]. RGE also increased the numbers of CD11c+ dendritic cells, IFN-γ-secreting CD8+ T cells, and CD4+ T cells in bronchoalveolar lavage fluids [20], [21]. Taken together, these studies demonstrate that ginseng has immunomodulatory and antiviral effects against RSV infection through multiple mechanisms, and further studies are required to elucidate the underlying immunoregulatory and antiviral mechanisms at the molecular level.

3. Rhinovirus

Rhinovirus is the major cause of the common cold. Rhinovirus is transmitted from person-to-person via contact or aerosol and causes upper respiratory illness [22]. Although generally mild and self-limiting, rhinovirus infection may cause asthma or chronic obstructive pulmonary disease in chronic infection and lead to severe complications for asthmatics, elderly people, and immunocompromised patients [23], [24]. Currently there is no cure or prevention for rhinovirus infection, and treatment mainly relies on symptom alleviation using nonsteroidal anti-inflammatory drugs (NSAIDs), nasal decongestants, and antihistamines. Nonetheless, consistent effort has been made to identify effective preventions and antiviral medication for rhinovirus [25].

In an attempt to investigate the effects of ginsenosides on rhinovirus infection, Song et al [26] examined the antiviral activities of protopanaxatriol (PT)-type ginsenosides (Re, Rf, and Rg2), and protopanaxadiol (PD)-type ginsenosides (Rb1, Rb2, Rc, and Rd). The results showed that PT-type ginsenosides protected HeLa cells from human rhinovirus 3 (HRV3)-induced cell death as determined by sulforhodamine B staining of viable cells and morphological assessment [26]. However, PD-type ginsenosides did not show any protective effects and even stimulated the HRV3-induced cell death significantly, implying a structure-dependent effect of ginsenosides on HRV3. The selective antiviral activities of panaxatriol-type ginsenosides were also found in the case of coxsackievirus, as described below. Future studies are needed to elucidate the relationship between the antiviral activities and structural differences among panaxadiol- and panaxatriol-type ginsenosides.

4. Influenza virus

Influenza virus is the most common human respiratory pathogen that causes annual endemic and periodic pandemic infection. There are three types of influenza viruses: A, B, and C. Human influenza A and B viruses cause seasonal disease nearly every winter, whereas the influenza C virus causes mild respiratory disease. Influenza A viruses are the most virulent human pathogens, and their serotypes are further classified and termed based on the viral surface proteins hemagglutinin (H) and neuraminidase (N). Novel mutant strains continuously emerge causing influenza pandemic outbreaks, and there were some historically renowned lethal strains such as “Spanish influenza (H1N1)”, “Asian influenza (H2N2)”, “Russian influenza (H1N1)”, “Hong Kong influenza (H5N1)”, and swine-origin H1N1 influenza recently found in Mexico [27], [28].

Ample studies have been conducted to demonstrate the antiviral activities of RGE and purified compounds present in ginseng on influenza virus A infection in vitro and in vivo. RGE treatment improved the viability of human alveolar epithelial A549 cells upon H1N1 infection accompanied by a decrease in virus-induced cytokine secretion and reactive oxygen species (ROS) formation [29]. Protopanaxatriol-type ginsenoside Re has been shown to protect human umbilical vein endothelial cells (HUVECs) from avian H9N2/G1 influenza-induced apoptosis by inhibiting virus-induced interferon-inducible protein-10 (IP-10) production [30]. The inhibitory effects of RGE on viral replication were also tested in Madin–Darby canine kidney (MDCK) cells using the 2009 pandemic H1N1 virus [31]. In in vivo studies, RGE, ginseng polysaccharide (GP), or ginseng saponin was orally administered to mice or ferrets prior to viral infection, and their protective effects were evaluated by measuring body weight, survival rate, lung viral titers, cytokine production, histopathology, etc. The antiviral effects on the H1N1 strain have been most widely tested, and those on H3N2, H9N2/G1 (avian influenza), and H5N1 were also examined. In detail, RGE has been reported to have antiviral effects on H1N1, H3N2, and H5N1 [31], [32]; GP has effects on H1N1 and H3N2 [33]; and saponin has an effect on H1N1 [34]. The antiviral activities of RGE, GP, and ginseng saponin fraction have also been compared using the H1N1 strain. Yin et al [34] showed that GP was the most effective in improving the symptoms of influenza virus infection, followed by RGE and saponin in that order.

In addition to antiviral activity, RGE also plays a role as a mucosal adjuvant against influenza virus A/PR8 during viral infection [35]. When administered with inactivated virus and RGE intranasally, immunized mice produced increased levels of influenza virus-specific antibodies with improved neutralizing activities in blood and mucosal secretions, notably the IgA antibody in the lung. RGE plus virus immunization also resulted in the enhanced secretion of Th1 and Th2-type cytokines in splenocytes upon challenge infection, although a Th2 type response was more remarkable. This adjuvant effect of RGE was comparable to that of conventional adjuvants such as aluminum hydroxide and cholera toxin. Additionally, immunization of mice with inactivated H3N2 influenza antigen and ginsenoside Re resulted in increased immune responses by elevating both Th1 and Th2 cell activities [2]. The secretion of serum-specific IgG1 and IgG2a and hemagglutination inhibition titers were all increased, and in vitro stimulation of splenocytes produced higher levels of Th1 and Th2 cytokines in ginsenoside Re-administered mice. Furthermore, dietary intake of RGE and Korean Red Ginseng saponin (KRGS) has also been shown to improve H1N1 vaccine efficacy by increasing anti-influenza virus A-specific IgG titers and survival rates [36]. In addition, GP induced cross-protective vaccine efficacy. When mice were vaccinated with influenza virus-like particles (VLPs) originating from H1N1 together with GP, the immunized mice developed heterosubtypic protection and survived a lethal challenge with the H3N2 virus. Taken together, the data suggest the use of RGE, KRGS, ginsenoside Re, and GP as adjuvant or dietary supplements to enhance the vaccine-induced immune response and improve protection against influenza virus infection.

5. Human immunodeficiency virus

Human immunodeficiency virus (HIV) belongs to the genus Lentivirus in the family Retroviridae, and two types of HIV have been characterized: HIV-1 and HIV-2 [37]. HIV-1 is the major type of HIV accounting for 95% of infections worldwide and is more virulent and infectious than HIV-2 [38]. HIV-2 is mainly seen in West Africa and has lower infectivity [39], [40]. There are well-defined stages of HIV disease progression from acute infection, clinical latency, and acquired immunodeficiency syndrome AIDS, and an HIV-positive patient is diagnosed with AIDS when his/her CD4+ cell count falls < 200 cells/mm3. HIV treatment or highly active antiretroviral therapy (HAART) involves the combination of multiple drugs with different mechanisms of action. HAART can effectively suspend or prevent disease progression from one stage to the next and prolong the lives of HIV-positive patients dramatically by lowering the viral load, maintaining immune system function, and preventing opportunistic infections [7], [41]

When combined with zidovudine monotherapy or HAART, RGE has been shown to exert antiviral effects by maintaining CD4+ T cell counts [42], [43], [44], [45] and delaying the occurrence of resistance mutation [42], [43], [46] in HIV-1 patients. RGE treatment alone even showed significant antiHIV effects [44], [47], [48], [49], implying that RGE intake may become an alternative form of treatment for HIV-1 patients. Negative factor (Nef) is a virulence factor required for achieving high virus load and the progression to AIDS [50]. The 5′ long terminal repeat (LTR) acts as a promoter of the entire viral genome and stimulates viral genome replication, whereas group-specific antigen (gag) promotes the formation of fully infectious HIV-1 virions. Interestingly, RGE intake increases the frequency of gross deletions in Nef genes [51], [52], [53], [54] and the 5′ LTR/gag gene [53], [55], [56], leading to a delay in disease progression and increase of survival rate in HIV-1 patients.

Although most studies evaluating the effects of ginseng on HIV-1 have been carried out in HIV-1 patients, several in vitro studies have also been performed. For example, a homodimeric protein, quinqueginsin, isolated from the roots of American ginseng Panax quinquefolium, and xylanase, isolated from the roots of Panax notoginseng, have been shown to inhibit reverse transcriptase in a cell-free system [57], [58]. Additionally, ginsenoside Rh1, ginsenoside Rb1, and compound K have been reported to inhibit cytoprotective effects which may contribute to the long-term survival and persistent HIV-1 production in cells constitutively expressing transactivator (Tat) proteins [59], [60], [61].

In addition to antiviral effects, ginseng interacts with antiHIV drugs and changes their pharmacokinetic properties. Shi et al [62] have reported that ginsenoside Rh2 increased the accumulation and decreased the efflux of ritonavir through P-glycoprotein (P-gp) in Caco-2 cells and MDCK-MDR1 cells. An in vivo study using rats confirmed that intravenous administration of ginsenoside Rh2 inhibited ritonavir efflux and increased the plasma level of ritonavir. However, American ginseng, Panax quinquefolium, did not affect the pharmacokinetics of an antiHIV drug cotreated in humans, although it induced phase 2 enzyme quinone reductase [63]. Kaempferol isolated from ginseng has also been reported to inhibit P-gp-mediated efflux of ritonavir and cytochrome P-450 3A4 (CYP3A4) activities in vitro [64], but it has not been confirmed whether kaempferol would indeed induce the level of ritonavir in vivo.

6. Human herpesvirus

The herpesviruses are a group of large DNA viruses causing lytic, persistent, and latent/recurrent infections [65]. The human herpesviruses (HHV) are further divided into three subfamilies, alphaherpesvirinae [including herpes simplex virus-1 (HSV-1), herpes simplex virus-2 (HSV-2), and varicella-zoster virus (VZV)], betaherpesvirinae, and gammaherpesvirinae based on the differences in factors such as tissue tropism, pathogenesis, and site of latent infection [66]. HSV-1 is typically transmitted during childhood by contact with infected skin and is associated with orofacial infections and encephalitis [67], [68], although HSV-2 is transmitted by sexual activity and causes genital herpes mostly [68].

Notoginsenoside ST-4 is a dammarane-type saponin of Panax notoginseng and has been reported to show antiHSV activity by inhibiting the penetration of HSV-1 into Vero cells [69]. Another in vitro study has shown that ginsenoside Rb1 promotes cell proliferation and inhibits the apoptosis of human glioma cells upon HSV infection, suggesting the potential application of ginsenoside Rb1 to prevent neuronal cell death in viral encephalitis [70]. The antiHSV-1 activity of RGE has also been reported in vivo. When Balb/c mice were administered 200 mg/kg or 400 mg/kg of RGE orally for 10 days and infected with HSV-1, the RGE-treated mice became more resistant to vaginal and systemic infection as shown by a decrease in clinical severity and increase in survival rate and viral clearance. RGE also stimulated IFN-γ secretion in vaginal lavage fluid and increased the expression of IFN-γ, granzyme B, and Fas-Ligand mRNA in lymph nodes and vaginal tissue, suggesting that RGE protects the host from HSV-1 infection by stimulating natural killer (NK) cell activities [71]. Given the diverse antiviral activities of RGE through the inhibition of viral penetration and cell death and NK cell activation, prophylactic use of RGE would be beneficial for preventing or alleviating primary and recurrent HSV infection in combination with conventional antiviral drugs [72].

7. Hepatitis A virus

Hepatitis A virus (HAV) is a positive-sense, single-stranded RNA virus, belonging to the family Picornaviridae. Unlike hepatitis B virus (HBV), which is transmitted through exposure to blood and various body fluids of infected people, HAV is largely transmitted by the fecal–oral route and causes acute hepatitis. Although hepatitis A infection does not lead to chronic liver disease and has very low mortality, it may cause enervating symptoms and fulminant hepatitis (acute liver failure) [4]. Currently, no specific antiviral agent is available for HAV, and thus, prevention via vaccination and improvement of hygiene and sanitation is the most effective approach against the HAV infection.

Lee et al [73] examined the antiviral effects of RGE and purified ginsenosides Rb1 and Rg1 against HAV infection. They demonstrated that pretreatment or cotreatment with RGE and ginsenosides Rb1 and Rg1 on FRhK-4 cells derived from the monkey kidney decreased the HAV titer upon HAV infection in vitro. Although the antiviral effect of RGE and ginsenosides remained limited to the in vitro model, the report suggested that regular intake of KRG as a dietary supplement may help prevent HAV infection.

8. Hepatitis B virus

Hepatitis B virus (HBV) is a double-stranded DNA virus classified as being in the family Hepadnaviridae [74]. HBV can cause acute hepatitis, but it can also develop into a long-term, chronic infection. As chronic hepatitis B can lead to life-threatening cirrhosis or hepatocarcinoma, HBV infection is one of the most serious health problems worldwide [75]. During viral replication, large amounts of HBV surface antigen (HBsAg), HBV envelope antigen (HBeAg), and virions are released in the blood, and accordingly, diagnostic tests for HBV infection involve the detection of those viral antigens, virions, and antibodies to the viral antigens.

The antiHBV effect of ginsenoside Rg3 has been well-described [76]. Ginsenoside Rg3 remarkably inhibited the secretion of HBsAg, HBeAg, and viral particles in HBV-infected HepG2.2.15 cells. Another mechanistic study revealed that ginsenoside Rg3 downregulated TNF receptor-associated factor 6 (TRAF6)/transforming growth factor β activated kinase-1 (TAK1) and inhibited the mitogen-activated protein kinase (MAPK) signaling pathway by impeding c-Jun phosphorylation and reducing AP-1 expression. Consequently, the expression of proinflammatory cytokines such as IL-8 and TNF-α was reduced. Although the anti-inflammatory activity of ginsenoside Rg3 is explicitly described, it is unclear how the anti-inflammatory effect of ginsenoside Rg3 affects HBV replication. Future studies should strive to better understand the link between antiHBV and anti-inflammatory activities of ginsenoside Rg3.

9. Norovirus

Norovirus is a positive-sense, single-stranded RNA virus causing nausea, vomiting, abdominal pain, and diarrhea in humans [77]. The virus is spread through the fecal–oral route by ingestion of contaminated water or food, especially fish and shellfish [78]. As human norovirus is not culturable, norovirus surrogates such as feline calicivirus (FCV), murine norovirus (MNV), and Tulane virus (TV) are used to test the antiviral activity of natural or chemical compounds against norovirus [79]. FCV and MNV have a similar genome organization, physical properties, and replication cycle to those of human norovirus and can be cultivated in Crandell–Reese feline kidney (CRFK) cells and murine Raw264.7 cells, respectively [80].

Lee et al [81] have shown that pretreatment of CRFK or RAW264.7 cells with RGE and ginsenosides Rb1 or Rg1 significantly reduced FCV and MNV titers in vitro, whereas cotreatment or posttreatment had no antiviral effects. In a subsequent study, the same research group demonstrated that RGE and ginsenosides pretreatment induced antiviral proteins in FCV-infected CRFK cells. The expressions of IFN-α, IFN-β, IFN-ω, zinc finger antiviral protein shorter isoform (ZAPS), and Mx protein, an IFN-inducible protein with antiviral activity, were all increased which contributed to the decrease of viral titers in CRFK cells. Future studies are needed to establish a culture system for human norovirus and subsequently evaluate the antiviral effects of RGE and ginsenosides against human norovirus.

10. Rotavirus

Rotavirus is the leading cause of acute gastroenteritis in young children age ≤ 5 years [82]. Two live oral rotavirus vaccines (Rotarix by GlaxoSmithKline, Unitied Kingdom, and RotaTeq by Merck, United States) are available, and the implementation of rotavirus vaccines in childhood immunization programs has significantly reduced the morbidity and mortality associated with Rotavirus infection [6]. Nevertheless, there is no antiviral drug to treat rotavirus infection, and mostly, therapeutics involve the prevention of dehydration [83], [84].

In traditional medicine, ginseng has been known to improve gastrointestinal function and prevent gastrointestinal problems such as diarrhea [3]. A recent study researched the active constituent in ginseng and reported that two pectic polysaccharides isolated from hot water extract of ginseng prevented cell death from viral infection [3]. The polysaccharides, named GP50-dHR and GP50-her, did not have virucidal effects but inhibited viral attachment to the host cells thereby protecting them from virus-induced cell death. Given these results and an additional report that other pectin-type polysaccharides in ginseng inhibited the adherence of Helicobacter pylori to gastric epithelial cells and the ability of Porphyromonas gingivalis to agglutinate erythrocytes [85], further evaluation of the antimicrobial effects of acidic polysaccharides with the structure of pectin is merited.

11. Enterovirus

Human enterovirus 71 (EV71) and coxsackievirus A16 (CVA16) are the two major causes of hand-foot-and-mouth disease (HFMD) in young children [86]. Although HFMD is a mild and self-limited disease characterized by fever, rash, bumps, blisters, or ulcers in the mouth, feet, hands, and buttocks, some affected children may develop neurological, cardiovascular, and respiratory complications in rare cases [87], [88]. Presently, there are no specific treatments or vaccines for HFMD.

In order to identify ginsenosides with antiviral activity against EV71, Song et al [26] tested panaxadiol-type ginsenosides (Rb1, Rb2, Rc, and Rd) and panaxatriol-type ginsenosides (Re, Rf, and Rg2). They found that only ginsenoside Rg2 had antiviral activity against EV71 infection in Vero cells, but it has not been determined whether the anticytopathic effect of Rg2 is due to the virucidal activity or the inhibition of viral attachment.

12. Coxsackievirus

Coxsackievirus is a positive-sense, single-stranded RNA virus, belonging to Picornaviridae. Coxsackieviruses are divided into the group A virus with 23 serotypes and the group B virus with six serotypes [89], [90]. Among those, the most common pathogens are coxsackievirus A16 (CVA16) causing HFMD as described above and coxsackievirus B3 (CVB3) causing myocarditis, aseptic meningitis, and pancreatitis [91], [92]. At present, there is no effective therapeutic agent against CVB3, and only ribavirin is available for CVB3 infection despite its weak antiviral activity [93].

20(S)-Protopanaxtriol is one of the major triterpenes isolated from Panax notoginseng [94]. It has been shown that 20(S)-protopanaxtriol has potent antiCVB3 activities in vitro and in vivo. The IC50 of 20(S)-protopanaxtriol for inhibition of CVB3 replication in HeLa cells was even lower than that of ribavirin, indicating a stronger antiviral effect than ribavirin. In vivo experiments showed that treatment of CVB3-infected mice with 20(S)-protopanaxtriol significantly improved CVB3-induced myocarditis represented by a decrease in the activities of lactase dehydrogenase and creatine kinase, markers for myocardial injury.

In addition, panaxatriol-type ginsenosides such as ginsenosides Re, Rf, and Rg2 also showed significant antiCVB3 activity represented by a decrease in the CVB3-induced cytopathic effect and an increase in the cell viability of infected Vero cells [26]. The antiCVB3 activity of ginsenosides Re and Rf was comparable to that of ribavirin. However, panaxadiol-type ginsenosides such as Rb1, Rb2, Rc, and Rd did not exhibit antiCVB3 activity.

13. Conclusion

The swift emergence of new infectious viruses and drug-resistant variants has limited the availability of effective antiviral agents and vaccines. Thus, the development of broad-spectrum antivirals and immunomodulating agents that stimulate host immunity and improve host resilience is essential. Although ginseng itself can exert direct antiviral effects by inhibiting viral attachment, membrane penetration, and replication, the foremost antiviral activities of ginseng are attributed to the enhancement of host immunity. Future studies should include the identification of essential components responsible for the enhanced immunity against any viral attack.

Conflicts of interest

None declared.

Acknowledgments

This work was supported by the National Research Foundation (NRF) funded by the Ministry of Science, ICT, and Future Planning (NRF-2013R1A1A3005097).

References

1. Munoz F.M. Respiratory syncytial virus in infants: is maternal vaccination a realistic strategy? Curr Opin Infect Dis. 2015;28:221–224. [PubMed]
2. Song X., Chen J., Sakwiwatkul K., Li R., Hu S. Enhancement of immune responses to influenza vaccine (H3N2) by ginsenoside Re. Int Immunopharmacol. 2010;10:351–356. [PubMed]
3. Baek S.H., Lee J.G., Park S.Y., Bae O.N., Kim D.H., Park J.H. Pectic polysaccharides from Panax ginseng as the antirotavirus principals in ginseng. Biomacromolecules. 2010;11:2044–2052. [PubMed]
4. Martin A., Lemon S.M. Hepatitis A virus: from discovery to vaccines. Hepatology. 2006;43:S164–S172. [PubMed]
5. Nichol K.L., Lind A., Margolis K.L., Murdoch M., McFadden R., Hauge M., Magnan S., Drake M. The effectiveness of vaccination against influenza in healthy, working adults. N Engl J Med. 1995;333:889–893. [PubMed]
6. Munos M.K., Walker C.L., Black R.E. The effect of rotavirus vaccine on diarrhoea mortality. Int J Epidemiol. 2010;39(Suppl. 1):i56–i62. [PubMed]
7. Porter K., Babiker A., Bhaskaran K., Darbyshire J., Pezzotti P., Walker A.S. Determinants of survival following HIV-1 seroconversion after the introduction of HAART. Lancet. 2003;362:1267–1274. [PubMed]
8. Chin'ombe N., Ruhanya V. HIV/AIDS vaccines for Africa: scientific opportunities, challenges and strategies. Pan Afr Med J. 2015;20:386. [PubMed]
9. Ha S.-J., West E.E., Araki K., Smith K.A., Ahmed R. Manipulating both the inhibitory and stimulatory immune system towards the success of therapeutic vaccination against chronic viral infections. Immunol Rev. 2008;223:317–333. [PubMed]
10. Kiefer D., Pantuso T. Panax ginseng. Am Fam Physician. 2003;68:1539–1542. [PubMed]
11. Park J., Rhee D., Lee Y. Biological activities and chemistry of saponins from Panax ginseng C. A. Meyer. Phytochem Rev. 2005;4:159–175.
12. Jang D.-J., Lee M.S., Shin B.-C., Lee Y.-C., Ernst E. Red ginseng for treating erectile dysfunction: a systematic review. Br J Clin Pharmacol. 2008;66:444–450. [PubMed]
13. Kim W.Y., Kim J.M., Han S.B., Lee S.K., Kim N.D., Park M.K., Kim C.K., Park J.H. Steaming of ginseng at high temperature enhances biological activity. J Nat Prod. 2000;63:1702–1704. [PubMed]
14. Kim S.K., Park J.H. Trends in ginseng research in 2010. J Ginseng Res. 2011;35:389–398. [PubMed]
15. Helms S. Cancer prevention and therapeutics: Panax ginseng. Altern Med Rev. 2004;9:259–274. [PubMed]
16. Kim S., Lee Y., Cho J. Korean red ginseng extract exhibits neuroprotective effects through inhibition of apoptotic cell death. Biol Pharm Bull. 2014;37:938–946. [PubMed]
17. Vuksan V., Sievenpipper J., Jovanovski E., Jenkins A.L. Current clinical evidence for Korean red ginseng in management of diabetes and vascular disease: a Toronto's ginseng clinical testing program. J Ginseng Res. 2010;34:264–273.
18. Lim D.S., Bae K.G., Jung I.S., Kim C.H., Yun Y.S., Song J.Y. Anti-septicaemic effect of polysaccharide from Panax ginseng by macrophage activation. J Infect. 2002;45:32–38. [PubMed]
19. Lee J.S., Cho M.K., Hwang H.S., Ko E.J., Lee Y.N., Kwon Y.M., Kim M.C., Kim K.H., Lee Y.T., Jung Y.J. Ginseng diminishes lung disease in mice immunized with formalin-inactivated respiratory syncytial virus after challenge by modulating host immune responses. J Interferon Cytokine Res. 2014;34:902–914. [PubMed]
20. Lee J.S., Lee Y.N., Lee Y.T., Hwang H.S., Kim K.H., Ko E.J., Kim M.C., Kang S.M. Ginseng protects against respiratory syncytial virus by modulating multiple immune cells and inhibiting viral replication. Nutrients. 2015;7:1021–1036. [PubMed]
21. Lee J.S., Ko E.J., Hwang H.S., Lee Y.N., Kwon Y.M., Kim M.C., Kang S.M. Antiviral activity of ginseng extract against respiratory syncytial virus infection. Int J Mol Med. 2014;34:183–190. [PubMed]
22. Hendley J.O., Gwaltney J.M., Jr. Mechanisms of transmission of rhinovirus infections. Epidemiol Rev. 1988;10:243–258. [PubMed]
23. Seemungal T., Harper-Owen R., Bhowmik A., Moric I., Sanderson G., Message S., Maccallum P., Meade T.W., Jeffries D.J., Johnston S.L. Respiratory viruses, symptoms, and inflammatory markers in acute exacerbations and stable chronic obstructive pulmonary disease. Am J Respir Crit Care Med. 2001;164:1618–1623. [PubMed]
24. Jarjour N.N., Gern J.E., Kelly E.A.B., Swenson C.A., Dick C.R., Busse W.W. The effect of an experimental rhinovirus 16 infection on bronchial lavage neutrophils. J Allergy Clin Immunol. 2000;105:1169–1177. [PubMed]
25. Charles C.H., Yelmene M., Luo G.X. Recent advances in rhinovirus therapeutics. Curr Drug Targets Infect Disord. 2004;4:331–337. [PubMed]
26. Song J.H., Choi H.J., Song H.H., Hong E.H., Lee B.R., Oh S.R., Choi K., Yeo S.G., Lee Y.P., Cho S. Antiviral activity of ginsenosides against coxsackievirus B3, enterovirus 71, and human rhinovirus 3. J Ginseng Res. 2014;38:173–179. [PubMed]
27. Neumann G., Noda T., Kawaoka Y. Emergence and pandemic potential of swine-origin H1N1 influenza virus. Nature. 2009;459:931–939. [PubMed]
28. Claas E.C., Osterhaus A.D., van Beek R., De Jong J.C., Rimmelzwaan G.F., Senne D.A., Krauss S., Shortridge K.F., Webster R.G. Human influenza A H5N1 virus related to a highly pathogenic avian influenza virus. Lancet. 1998;351:472–477. [PubMed]
29. Lee J.S., Hwang H.S., Ko E.J., Lee Y.N., Kwon Y.M., Kim M.C., Kang S.M. Immunomodulatory activity of red ginseng against influenza A virus infection. Nutrients. 2014;6:517–529. [PubMed]
30. Chan L.Y., Kwok H.H., Chan R.W., Peiris M.J., Mak N.K., Wong R.N., Chan M.C., Yue P.Y. Dual functions of ginsenosides in protecting human endothelial cells against influenza H9N2-induced inflammation and apoptosis. J Ethnopharmacol. 2011;137:1542–1546. [PubMed]
31. Yoo D.G., Kim M.C., Park M.K., Song J.M., Quan F.S., Park K.M., Cho Y.K., Kang S.M. Protective effect of Korean red ginseng extract on the infections by H1N1 and H3N2 influenza viruses in mice. J Med Food. 2012;15:855–862. [PubMed]
32. Park E.H., Yum J., Ku K.B., Kim H.M., Kang Y.M., Kim J.C., Kim J.A., Kang Y.K., Seo S.H. Red Ginseng-containing diet helps to protect mice and ferrets from the lethal infection by highly pathogenic H5N1 influenza virus. J Ginseng Res. 2014;38:40–46. [PubMed]
33. Yoo D.G., Kim M.C., Park M.K., Park K.M., Quan F.S., Song J.M., Wee J.J., Wang B.Z., Cho Y.K., Compans R.W. Protective effect of ginseng polysaccharides on influenza viral infection. PLoS One. 2012;7:e33678. [PubMed]
34. Yin S.Y., Kim H.J. A comparative study of the effects of whole red ginseng extract and polysaccharide and saponin fractions on influenza A (H1N1) virus infection. Biol Pharm Bull. 2013;36:1002–1007. [PubMed]
35. Quan F.S., Compans R.W., Cho Y.K., Kang S.M. Ginseng and Salviae herbs play a role as immune activators and modulate immune responses during influenza virus infection. Vaccine. 2007;25:272–282. [PubMed]
36. Xu M.L., Kim H.J., Choi Y.R. Intake of korean red ginseng extract and saponin enhances the protection conferred by vaccination with inactivated influenza a virus. J Ginseng Res. 2012;36:396–402. [PubMed]
37. Zagury J.F., Franchini G., Reitz M., Collalti E., Starcich B., Hall L., Fargnoli K., Jagodzinski L., Guo H.G., Laure F. Genetic variability between isolates of human immunodeficiency virus (HIV) type 2 is comparable to the variability among HIV type 1. Proc Natl Acad Sci USA. 1988;85:5941–5945. [PubMed]
38. Kanki P.J., Travers K.U., Mboup S., Hsieh C.C., Marlink R.G., Gueye-NDiaye A., Siby T., Thior I., Hernandez-Avila M., Sankalé J.L. Slower heterosexual spread of HIV-2 than HIV-1. Lancet. 1994;343:943–946. [PubMed]
39. Requejo H.I. Worldwide molecular epidemiology of HIV. Rev Saude Publica. 2006;40:331–345. [PubMed]
40. de Silva T.I., Cotten M., Rowland-Jones S.L. HIV-2: the forgotten AIDS virus. Trends Microbiol. 2008;16:588–595. [PubMed]
41. Moore R.D., Chaisson R.E. Natural history of HIV infection in the era of combination antiretroviral therapy. AIDS. 1999;13:1933–1942. [PubMed]
42. Cho Y.K., Sung H., Lee H.J., Joo C.H., Cho G.J. Long-term intake of Korean red ginseng in HIV-1-infected patients: development of resistance mutation to zidovudine is delayed. Int Immunopharmacol. 2001;1:1295–1305. [PubMed]
43. Sung H., Jung Y.S., Cho Y.K. Beneficial effects of a combination of Korean red ginseng and highly active antiretroviral therapy in human immunodeficiency virus type 1-infected patients. Clin Vaccine Immunol. 2009;16:1127–1131. [PubMed]
44. Cho Y.K., Lee I.C., Shin Y.O. The effect of Korean red ginseng (KRG), zidovudine (ZDV), and the combination of KRG and ZDV on HIV-infected individuals. J Bacteriol Virol. 1996;31:353–360.
45. Kim B.R., Kim J.E., Sung H., Cho Y.K. Long-term follow up of HIV-1-infected Korean haemophiliacs, after infection from a common source of virus. Haemophilia. 2015;21:e1–11. [PubMed]
46. Cho Y.K., Sung H., Ahn S.H., Bae I.G., Woo J.H., Won Y.H., Kim D.G., Kang M.W. Frequency of mutations conferring resistance to nucleoside reverse transcriptase inhibitors in human immunodeficiency virus type 1-infected patients in Korea. J Clin Microbiol. 2002;40:1319–1325. [PubMed]
47. Sung H., Kang S.M., Lee M.S., Kim T.G., Cho Y.K. Korean red ginseng slows depletion of CD4 T cells in human immunodeficiency virus type 1-infected patients. Clin Diagn Lab Immunol. 2005;12:497–501. [PubMed]
48. Cho Y.-K., Sung H., Kim T.K., Lim J.Y., Jung Y.S., Kang S.-M. Korean red ginseng significantly slows CD4 T cell depletion over 10 years in HIV-1 infected patients: association with HLA. J Ginseng Res. 2004;28:173–182.
49. Cho Y.K., Kim Y.B., Kim Y.K., Lee H.J., Oh W.I. Sequence analysis of C2-V3 region of human immunodeficiency virus type 1 gp120 and its correlation with clinical significance: the effect of long-term intake of Korean red ginseng on env gene variation. J Korean Soc Microbiol. 1997;32:611–623.
50. Das S.R., Jameel S. Biology of the HIV Nef protein. Indian J Med Res. 2005;121:315–332. [PubMed]
51. Cho Y.K., Jung Y.S., Sung H. Frequent gross deletion in the HIV type 1 nef gene in hemophiliacs treated with Korean Red Ginseng: inhibition of detection by highly active antiretroviral therapy. AIDS Res Hum Retroviruses. 2009;25:419–424. [PubMed]
52. Cho Y.K., Lim J.Y., Jung Y.S., Oh S.K., Lee H.J., Sung H. High frequency of grossly deleted nef genes in HIV-1 infected long-term slow progressors treated with Korean red ginseng. Curr HIV Res. 2006;4:447–457. [PubMed]
53. Cho Y.K., Jung Y.S., Sung H., Sim M.K., Kim Y.K. High frequency of gross deletions in 5′ LTR/gag and nef genes in patients infected with CRF02_AG of HIV type 1 who survived for over 20 years: an association with Korean red ginseng. AIDS Res Hum Retroviruses. 2009;25:535–541. [PubMed]
54. Cho Y.K., Jung Y.S. Dosage and duration effects of Korean red ginseng intake on frequency of gross deletions in the nef gene. J Ginseng Res. 2010;34:219–226.
55. Cho Y.K., Jung Y.S. High frequency of gross deletions in the 5' LTR and gag regions in HIV type 1-infected long-term survivors treated with Korean red ginseng. AIDS Res Hum Retroviruses. 2008;24:181–193. [PubMed]
56. Cho Y.K., Jung Y., Sung H., Joo C.H. Frequent genetic defects in the HIV-1 5′ LTR/gag gene in hemophiliacs treated with Korean Red Ginseng: decreased detection of genetic defects by highly active antiretroviral therapy. J Ginseng Res. 2011;35:413–420. [PubMed]
57. Wang H.X., Ng T.B. Quinqueginsin, a novel protein with anti-human immunodeficiency virus, antifungal, ribonuclease and cell-free translation-inhibitory activities from American ginseng roots. Biochem Biophys Res Commun. 2000;269:203–208. [PubMed]
58. Lam S.K., Ng T.B. A xylanase from roots of sanchi ginseng (Panax notoginseng) with inhibitory effects on human immunodeficiency virus-1 reverse transcriptase. Life Sci. 2002;70:3049–3058. [PubMed]
59. Jeong J.J., Kim B., Kim D.H. Ginsenoside Rh1 eliminates the cytoprotective phenotype of human immunodeficiency virus type 1-transduced human macrophages by inhibiting the phosphorylation of pyruvate dehydrogenase lipoamide kinase isozyme 1. Biol Pharm Bull. 2013;36:1088–1094. [PubMed]
60. Jeong J.J., Kim B., Kim D.H. Ginsenoside Rb1 eliminates HIV-1 (D3)-transduced cytoprotective human macrophages by inhibiting the AKT pathway. J Med Food. 2014;17:849–854. [PubMed]
61. Kim Y., Hollenbaugh J.A., Kim D.H., Kim B. Novel PI3K/Akt inhibitors screened by the cytoprotective function of human immunodeficiency virus type 1 Tat. PLoS One. 2011;6:e21781. [PubMed]
62. Shi J., Cao B., Zha W.B., Wu X.L., Liu L.S., Xiao W.J., Gu R.R., Sun R.B., Yu X.Y., Zheng T. Pharmacokinetic interactions between 20(S)-ginsenoside Rh2 and the HIV protease inhibitor ritonavir in vitro and in vivo. Acta Pharmacol Sin. 2013;34:1349–1358. [PubMed]
63. Lee L.S., Wise S.D., Chan C., Parsons T.L., Flexner C., Lietman P.S. Possible differential induction of phase 2 enzyme and antioxidant pathways by american ginseng, Panax quinquefolius. J Clin Pharmacol. 2008;48:599–609. [PubMed]
64. Patel J., Buddha B., Dey S., Pal D., Mitra A.K. In vitro interaction of the HIV protease inhibitor ritonavir with herbal constituents: changes in P-gp and CYP3A4 activity. Am J Ther. 2004;11:262–277. [PubMed]
65. Kukhanova M.K., Korovina A.N., Kochetkov S.N. Human herpes simplex virus: life cycle and development of inhibitors. Biochemistry (Mosc) 2014;79:1635–1652. [PubMed]
66. McGeoch D.J., Cook S., Dolan A., Jamieson F.E., Telford E.A.R. Molecular phylogeny and evolutionary timescale for the family of mammalian herpesviruses. J Mol Biol. 1995;247:443–458. [PubMed]
67. Kimberlin D.W. Herpes simplex virus infections in neonates and early childhood. Semin Pediatr Infect Dis. 2005;16:271–281. [PubMed]
68. Gupta R., Warren T., Wald A. Genital herpes. Lancet. 2007;370:2127–2137. [PubMed]
69. Pei Y., Du Q., Liao P.Y., Chen Z.P., Wang D., Yang C.R., Kitazato K., Wang Y.F., Zhang Y.J. Notoginsenoside ST-4 inhibits virus penetration of herpes simplex virus in vitro. J Asian Nat Prod Res. 2011;13:498–504. [PubMed]
70. Liang Y.Y., Wang B., Qian D.M., Li L., Wang Z.H., Hu M., Song X.X. Inhibitory effects of Ginsenoside Rb1 on apoptosis caused by HSV-1 in human glioma cells. Virol Sin. 2012;27:19–25. [PubMed]
71. Cho A., Roh Y.S., Uyangaa E., Park S., Kim J.W., Lim K.H., Kwon J., Eo S.K., Lim C.W., Kim B. Protective effects of red ginseng extract against vaginal herpes simplex virus infection. J Ginseng Res. 2013;37:210–218. [PubMed]
72. Perfect M.M., Bourne N., Ebel C., Rosenthal S.L. Use of complementary and alternative medicine for the treatment of genital herpes. Herpes. 2005;12:38–41. [PubMed]
73. Lee M.H., Lee B.H., Lee S., Choi C. Reduction of hepatitis A virus on FRhK-4 cells treated with Korean red ginseng extract and ginsenosides. J Food Sci. 2013;78:M1412–M1415. [PubMed]
74. Kramvis A., Kew M., Francois G. Hepatitis B virus genotypes. Vaccine. 2005;23:2409–2423. [PubMed]
75. Zhang Y.Q., Guo J.S. Antiviral therapies for hepatitis B virus-related hepatocellular carcinoma. World J Gastroenterol. 2015;21:3860–3866. [PubMed]
76. Kang L.J., Choi Y.J., Lee S.G. Stimulation of TRAF6/TAK1 degradation and inhibition of JNK/AP-1 signalling by ginsenoside Rg3 attenuates hepatitis B virus replication. Int J Biochem Cell Biol. 2013;45:2612–2621. [PubMed]
77. Atmar R.L., Estes M.K. Diagnosis of noncultivatable gastroenteritis viruses, the human caliciviruses. Clin Microbiol Rev. 2001;14:15–37. [PubMed]
78. Moore M.D., Goulter R.M., Jaykus L.A. Human norovirus as a foodborne pathogen: challenges and developments. Annu Rev Food Sci Technol. 2015;6:411–433. [PubMed]
79. Bae J., Schwab K.J. Evaluation of murine norovirus, feline calicivirus, poliovirus, and MS2 as surrogates for human norovirus in a model of viral persistence in surface water and groundwater. Appl Environ Microbiol. 2008;74:477–484. [PubMed]
80. Lee M.H., Lee B.H., Jung J.Y., Cheon D.S., Kim K.T., Choi C. Antiviral effect of korean red ginseng extract and ginsenosides on murine norovirus and feline calicivirus as surrogates for human norovirus. J Ginseng Res. 2011;35:429–435. [PubMed]
81. Lee M.H., Seo D.J., Kang J.H., Oh S.H., Choi C. Expression of antiviral cytokines in Crandell-Reese feline kidney cells pretreated with Korean red ginseng extract or ginsenosides. Food Chem Toxicol. 2014;70:19–25. [PubMed]
82. Bernstein D.I. Rotavirus overview. Pediatr Infect Dis J. 2009;28:S50–S53. [PubMed]
83. Parashar U.D., Gibson C.J., Bresse J.S., Glass R.I. Rotavirus and severe childhood diarrhea. Emerg Inf Dis. 2006;12:304–306. [PMC free article] [PubMed]
84. Victora C.G., Bryce J., Fontaine O., Monasch R. Reducing deaths from diarrhoea through oral rehydration therapy. Bull World Health Organ. 2000;78:1246–1255. [PubMed]
85. Lee J.H., Shim J.S., Lee J.S., Kim M.K., Chung M.S., Kim K.H. Pectin-like acidic polysaccharide from Panax ginseng with selective antiadhesive activity against pathogenic bacteria. Carbohydr Res. 2006;341:1154–1163. [PubMed]
86. Rabenau H.F., Richter M., Doerr H.W. Hand, foot and mouth disease: seroprevalence of Coxsackie A16 and Enterovirus 71 in Germany. Med Microbiol Immunol. 2010;199:45–51. [PubMed]
87. Chan L.G., Parashar U.D., Lye M.S., Ong F.G., Zaki S.R., Alexander J.P., Ho K.K., Han L.L., Pallansch M.A., Suleiman A.B. Deaths of children during an outbreak of hand, foot, and mouth disease in sarawak, malaysia: clinical and pathological characteristics of the disease. For the Outbreak Study Group. Clin Infect Dis. 2000;31:678–683. [PubMed]
88. Hamaguchi T., Fujisawa H., Sakai K., Okino S., Kurosaki N., Nishimura Y., Shimizu H., Yamada M. Acute encephalitis caused by intrafamilial transmission of enterovirus 71 in adult. Emerg Infect Dis. 2008;14:828–830. [PubMed]
89. Bruu A.L. 2nd ed. Wiley; NJ, United States: 2003. Enteroviruses: polioviruses, coxsackieviruses, echoviruses and newer enteroviruses. A practical guide to clinical virology; pp. 44–45.
90. Muir P., Kammerer U., Korn K., Mulders M.N., Poyry T., Weissbrich B., Kandolf R., Cleator G.M., van Loon A.M. Molecular typing of enteroviruses: current status and future requirements. The European Union concerted action on virus meningitis and encephalitis. Clin Microbiol Rev. 1998;11:202–227. [PubMed]
91. Gupta S., Markham D.W., Drazner M.H., Mammen P.P. Fulminant myocarditis. Nat Clin Pract Cardiovasc Med. 2008;5:693–706. [PubMed]
92. Tracy S., Gauntt C. Group B coxsackievirus virulence. Curr Top Microbiol Immunol. 2008;323:49–63. [PubMed]
93. Heim A., Grumbach I., Pring-Åkerblom P., Stille-Siegener M., Müller G., Kandolf R., Figulla H.-R. Inhibition of coxsackievirus B3 carrier state infection of cultured human myocardial fibroblasts by ribavirin and human natural interferon-α Antiviral Res. 1997;34:101–111. [PubMed]
94. Wang X., Wang Y., Ren Z., Qian C., Li Y., Wang Q., Zhang Y., Zheng L., Jiang J., Yang C. Protective effects of 20(s)-protopanaxtriol on viral myocarditis infected by coxsackievirus B3. Pathobiology. 2012;79:285–289. [PubMed]
Mise à jour le Dimanche, 24 Décembre 2017 10:36
 
C.115-Justifications par la biologie moléculaire de la dangérosité du vaccin contre l’hépatite B PDF Imprimer Envoyer
Écrit par Guy Mong Ky TRAN   
Jeudi, 09 Novembre 2017 16:17

C.115-Justifications par la biologie moléculaire de la dangérosité du vaccin contre l’hépatite B

Alors que les effets secondaires très graves de la vaccination contre l’hépatite B, rendu obligatoire par nos pouvoirs publics, sont niés tant par les laboratoires, des médecins incompétents ou corrompus, et les pouvoirs publics qui leur sont infeodés , nous allons apporter des éléments de preuve incontestable basés sur la biologie moléculaire.  Au niveau des faits constatés nous reprenons ceux décrits  dans le Livre de Lucienne Foucras «  Le nouveau dossier noir de la vaccination contre l’hépatite B » (Resurgence). Le mari  de Lucienne Foucras a subi un vrai calvaire: SLA, SGS et démyélinisation. On n'ose imaginer l'hécatombe d'enfants qui vont être sacrifiés à l'autel du veau d'or des financiers de Big Pharma.

A l'aulne des données du livre, je développe mes constatations scientifiques:

GenHevac B Sanofi-Pasteur-MSD : Pour la fabrication (ADN recombinant), ils utilisent larga manu:

1°) un promoteur de MMTV (le MMTV, Mouse Mammary Tumor Virus, comme son nom ne l'indique pas, donne des LYMPHOMES; c'est archi-connu, c'est publié)  et

2°) un promoteur de SV40 (même famille que les polyomavirus responsables de la LEMP DÉMYÉLINISANTE du Sida),

3°) ainsi que des cellules de hamster (animal faisant du diabète avec une facilité déconcertante: UN HAMSTER EST TOUJOURS spontanément peu ou prou DIABÉTIQUE)

L'utilisation de promoteurs rappelle les bébés-bulles de l'hôpital Necker (Pr Fischer A, consultant pro-vaccin du Ministère de la Santé, qui d'ailleurs n'a consulté aucun membre du Revhab, pour conclure à l'obligation vaccinale, par ordonnances: Il avait administré larga manu le LTR (un sigle bien mystérieux Long Terminal Repeat) du Moloney Mu LV (Murine Leukemia Virus), lequel LTR s'est empressé de provoquer des leucémies en pagaie chez les bébés-bulles. Le LTR était considéré, bien qu'extrait d'un virus LEUCEMOGENE, COMME TOTALEMENT INOFFENSIF; si ce n'est pas une expérimentation humaine, qu'est-ce que c'est? On n'a PAS prévu que le LTR soit si dangereux; en fait, on aurait dû, car dans la littérature, c'était déjà publié que cela donnait des leucémies chez le rongeur, mais comme personne ne lit de façon exhaustive la littérature mondiale, même ceux qui sont les plus spécialisés dans un seul domaine pointu, ce fait a été malheureusement méconnu).

Je me rappelle toujours quand j'en ai parlé (TRÈS RAPIDEMENT, LORS D'UN CROISEMENT FURTIF DANS LE COULOIR) à Klatzmann à Eurocancer, il n'y a pas prêté d'attention, car à l'époque personne ne pensait que le danger proviendrait de là: du LTR; un sigle bien mystérieux Long Terminal Repeat.

NOUS JOUONS AUX APPRENTIS SORCIERS AVEC LE GÉNOME.

 

et qu'est-ce que l'on trouve comme complications? (Revhab)

1°) Leucémies de l'enfance

2°) et affections démyélinisantes diverses (encephalopathies, encéphalites)

3°) ainsi que du diabète

N'importe quel médecin dirait que cela n'a rien à voir avec l'hépatite B (sauf le 2°),

mais n'importe quel quidam se poserait des questions légitimes sur les lymphomes du MMTV, les démyélinisations des polyomavirus et le diabète spontané du hamster.

 

Autre problème: les cellules d'ovaire de hamster chinois (CHO) sont contaminées par des RETROVIRUS,

autant dire que l'on injecte ces rétrovirus aux enfants.

qu'est ce qui donne un LUPUS? un rétrovirus (chez le chien)

qu'est-ce qui donne un syndrome de Gougerot-Sjogren? Un Rétrovirus (Tax d'HTLV-1, Mariette X)

qu'est-ce qui donne une paraparésie spastique (tropicale)? un rétrovirus le HTLV-1 (Gessain)

qu'est-ce qui donne une sclérose latérale amyotrophique mortelle à 100%  en 2-3 ans (LA SLA EST UNE PARAPLÉGIE SPASTIQUE)?

Le vaccin de Sanofi (utilisant des rétrovirus de CHO)

en gros , en tenant compte des non-notifications (les déclarations de SLA SONT INTROUVABLES, ELLES ONT DISPARUES, en particulier la déclaration du cas de SLA du mari de Lucienne Foucras- disparue, comme si cela n'avait JAMAIS existé), il y a 400 cas de SLA MORTELLES recensés par le Revhab. Ce qui est terrifiant avec la SLA, c'est que jusqu'au dernier souffle, le malade reste pleinement conscient qu'il va mourir, même trachéotomisé en chaise roulante puis dans son lit.

 

Qu'est-ce qu'on trouve dans la liste des complications?

Lupus, SGS, SLA

 

Chez GSK ENGERIX, ils utilisent la LEVURE

CE N'EST PAS MIEUX, car personne ne sait si un composant de la levure n'est pas dangereux

 

J'en veux pour preuve que lorsqu'on fabrique l'asparaginase (avec E.Coli), elle donne des pancréatites aigues; pourquoi ?

Parce que le RIBOSOME D'E.COLI contient dans sa sequence en acides aminés du CCKPZ (Cholecystokininepancreazymine) (mimétisme moléculaire : séquence commune WMDF Trp-Met-Asp-Phe) et que le CCKPZ provoque une pancréatite aiguë.

Mais seules certaines souches d'E.Coli en contiennent, d'autres pas.

L'asparaginase donne une pancréatite quand l'E.Coli contient le CCKPZ, mais quand une autre souche employée d'E.Coli n'en contient pas, il n'y a PAS de PANCRÉATITE.

Il y a donc 2 asparaginases: l'une dangereuse, l'autre pas. Tout dépend du process de fabrication; d'un "petit détail".

 

JE REVIENS À LA LEVURE DE GSK: L'Engerix est fabriqué avec de la levure, on pourrait croire que la levure, bof…

MAIS SI ON SE RAPPELLE E.Coli, ET LA PANCREATITE AIGUE de l'asparaginase, c'est bof aussi, le colibacille tout le monde en a; tout dépend de quel colibacille il s'agit.

La levure, elle, contamine le vaccin Engerix :

c'est là le danger; si la levure est une souche dangereuse, le vaccin sera dangereux; IL PEUT ARRIVER QUE, PARMI LES NOMBREUSES SOUCHES, LA LEVURE EMPLOYEE DANS LE VACCIN, SOIT DANGEREUSE (comme pour E.Coli).

(non publié, je ne peux pas m'avancer plus, en l'état actuel des recherches, car cela demande beaucoup de travail supplémentaire)

 

 

Pour les autres complications, c'est du mimétisme moléculaire avec HBs lui-même, l'antigène employé:

Périartérite noueuse (PAN) (non publié)

SEP (que j'ai publié il y a tellement longtemps (Journées de l'Internat, Auto-Immunité, 1998), mimétisme moléculaire de HBs avec la MBP de la MYÉLINE au niveau du tryptophane (il n'y a qu'un SEUL tryptophane dans la MBP, si on l’enlève, la myéline cesse d’être encéphalitogène), mais ils font tout pour étouffer l'info; heureusement, un Ecossais a vu mon poster, et il a empêché que l'Angleterre ne soit vaccinée par le vaccin anti-HBs). A l'époque le Dr Saliou (Institut Pasteur) m'avait répondu qu'on ne referait pas le vaccin, car ça coûterait trop cher. (Je lui avais suggéré de muter le tryptophane en sérine, comme dans l'hépatite du canard).

 

TRAN Guy Mong Ky

Retraité depuis 2014 de Santé Publique

Agence Régionale de Santé Auvergne Rhônes Alpes

Hôpital Hôtel Dieu Clermont-Ferrand

31 Avenue du Bois 92290 Châtenay Malabry

Tel : 09 81 89 38 70

Portable : 06 63 39 13 25

Mise à jour le Dimanche, 12 Novembre 2017 23:35
 
C.114- Highly pathogenic Influenza virus A H5N1 (Vietnam, Hong Kong) polymerase PB2 contains a snake PDF Imprimer Envoyer
Écrit par Guy Mong Ky TRAN   
Samedi, 04 Novembre 2017 18:05

 C.114- Highly pathogenic Influenza virus A H5N1 (Vietnam, Hong Kong) polymerase PB2 contains a snake disintegrin homologous to platelet integrin ITGA2b (gpIIb), which blocks the formation of platelet clot.

Présentation Poster au 8TH EUROPEAN MEETING ON VIRAL ZOONOSES( Saint Raphaël, France, Octobre 2017)

Guy Mong Ky Tran(1) & Adrien Caprani(2)

(1) Retired since 2014 from University of Auvergne Rhone-Alpes, Health Regional Agency, Public Health Department, Hospital Hotel-Dieu, Clermont-Ferrand ; 31 Av du Bois - Chatenay Malabry, France. email: Cette adresse email est protégée contre les robots des spammeurs, vous devez activer Javascript pour la voir.

(2) Association "Positifs", 147 chemin de la futaie, 83550 Vidauban, email: Cette adresse email est protégée contre les robots des spammeurs, vous devez activer Javascript pour la voir.

Avian Influenza virus A H5N1 is compared to chicken Ebola as its symptomatology is characterized by a massive internal hemorrhage. We have found in Influenza virus an urokinase-plasminogen activator and an epitope FP on the platelet surface integrin gpIIIa (ITGB3) inducing auto-antibodies against platelets ; here we focus on the hemorragin (hemorragic protein) from Crotalidae, Viperidae and australian Elapidae snakes, called also disintegrin (flavostatin, flavoviridin, trimestatin, echistatin gamma, applagin, ML-6,9,10) which contain a RGD adhesion motif, homologous to the RGN of platelet integrin ITGA2b. Disintegrin inhibits platelet aggregation induced by ADP, thrombin, collagen, arachidonic acid and thromboxan A2. By comparing ITGA2b, snake disintegrin to Influenza virus H5N1 (Hong Kong/Vietnam) polymerase PB2, we found an alignment centered on RGD:      ITGA2b          723-PMKKNAQI  GIaML V S  VGN-740

Influenza     48-(P,V)KaaRGQYSGF-VR(L,T)FQQ-65

ITGA2b         741-LEEAG(S,E)VSFQLQIRSKNSQNPNSKIVLLDVPVRAEA-777

Influenza    66-MRDVLGT(D,F)TVQIIKLLLPFAA(K,P)QSRMQFSSLT(N,V)VRGSG-106

Disintegrin  412-VEEcDcGSPSNPSNPccD/KFPLc/RPgaQcaSgLccDQcRFMKEGTI-454

ITGA2b                      778-QVELRGNSFPASLVV-792

Influenza                 108-MRILVRGNS-PAFNYN(A,K)T-125

Disintegrin                  455-CRIARGD-FPD-DYcNG K T-472

Despite the absence of any cysteine in ITGA2b and Influenza, the alignment could be done with disintegrin (13 cysteines, all gapped). Conclusion : The strategy of snake and Influenza virus is to mimic platelet integrin ITGA2b (gpIIb), particularly at the adhesion motif 783-RGNSFP-788, to block the aggregation of platelets and impede the formation of the platelet clot. Theoretically, a drug designed to mimic RGD by cyclisation (cycloRGD) would block the disintegrin. As the perturbation of coagulation in hemorragic Influenza is complex (fibrinolysis, auto-immune thrombocytopenia), the therapeutic approach must be a combination of plasminogen activator inhibitor, FP peptidomimetics, cycloRGD and heparin (Calciparin was efficient in a DIC induced by a Crotalus viridis bite, and also in Marburg). Whether selenium could be efficient, as it is in Haantan virus hemorragic fever, must be tried in Influenza. Ligands of the Na+ voltage-gated channel may be useful. Intriguingly, the Bost-Blalock theorem was confirmed in the case of RGD (ITGA2b) binding to FPVS (ITGB3).

 

 

 

 

Mise à jour le Samedi, 04 Novembre 2017 18:12
 
C.113-Highly pathogenic Influenza virus A H5N1 Indonesia & Vietnam Hemagglutinin (HA1) contains an u PDF Imprimer Envoyer
Écrit par Guy Mong Ky TRAN   
Samedi, 04 Novembre 2017 17:31

Highly pathogenic Influenza virus A H5N1 Indonesia & Vietnam Hemagglutinin (HA1) contains an urokinase-plasminogen activator explaining the fibrinolysis

 

Présentation Poster au 8TH EUROPEAN MEETING ON VIRAL ZOONOSES( Saint Raphaël, France, Octobre 2017)

Guy Mong Ky Tran(1) & Adrien Caprani(2)

(1) Retired since 2014 from University of Auvergne Rhone-Alpes, Health Regional Agency, Public Health Department, Hospital Hotel-Dieu, Clermont-Ferrand ; 31 Av du Bois - Chatenay Malabry, France. email: Cette adresse email est protégée contre les robots des spammeurs, vous devez activer Javascript pour la voir.

(2) Association "Positifs", 147 chemin de la futaie, 83550 Vidauban, email: Cette adresse email est protégée contre les robots des spammeurs, vous devez activer Javascript pour la voir.

 

Avian Influenza is compared to a chicken lethal Ebola for its internal hemorrhagic symptoms. Oseltamivir is inefficient and not recommanded in hemorragic influenza. In 1996, Zhilinskaia IN (Vopr Virusol) found by computer analysis a similarity between Influenza virus hemagglutinin HA and plasminogen activator (PA), explaining the fibrinolysis. We analysed further these results in Influenza virus A H5N1 Indonesia (83% mortality) and Vietnam HA1. We compared to urokinase (U-PA), tissue PA, TSV-PA, Batroxobin. Results : All the 3 active site residues of serine protease (His, Asp, Ser) were found and the best match was with U-PA :

H5N1 Indonesia/Vietnam             IPKSS-W--S-SH

U-PA/t-PA active site His               ILISScWviSaTH

H5N1 Indonesia/Vietnam                  G I HHpNDAAEQTK

U-PA/t-PA active site Asp      (A,L)HH NDI ALQ IR

H5N1 Vietnam                                KGDS- - TIMKS(L,E)EYGNCNTKCQTPMGA I

U-PA/t-PA active site Ser               QGDSggPLVcS L Q    WIRSHTKGEE- NG(A,L)

H5N1 Indonesia/Vietnam 141-YLGKSSF(R,F)N-150

U-PA                                                       YLGR-S(L,R)L N

Conversely, Influenza H7 China HA1 has His replaced by Arg, Asp replaced by Ser. The motif His-Phe (HF), in the pocket binding Plasminogen clivage site Arg-Ala-Arg, was present in Influenza H5N1 and U-PA (319-HF-320); but not in Influenza virus H7 China, replaced by Gly-Gly (inactive). Conclusion : The   plasminogen activator in avian Influenza virus H5N1 hemagglutinin HA1 ( Zhilinskaia ) was confirmed and may explain fibrinolysis in hemorrhagic Influenza. It seems rationale to use plasminogen inhibitors to block this fibrinolysis. A peptidomimetic drug  of the plasminogen Arg-Ala-Arg (RAR) at the cleavage site  Arg / Ala can  be designed by docking. This strategy was successful in HIV-1 tritherapy, with FP peptidomimetics.

 

Mise à jour le Samedi, 04 Novembre 2017 17:33
 
C.112-Highly pathogenic Influenza virus A H5N1 Vietnam Hemagglutinin (HA2) contains a scorpion alpha PDF Imprimer Envoyer
Écrit par Guy Mong Ky TRAN   
Samedi, 04 Novembre 2017 17:21

Highly pathogenic Influenza virus A H5N1 Vietnam Hemagglutinin (HA2) contains a scorpion alpha-toxin. Sodium channel inhibitors as therapy.

Présentation Poster au 8TH EUROPEAN MEETING ON VIRAL ZOONOSES( Saint Raphaël, France, Octobre 2017)

Guy Mong Ky Tran(1) & Adrien Caprani(2)

(1) Retired since 2014 from University of Auvergne Rhone-Alpes, Health Regional Agency, Public Health Department, Hospital Hotel-Dieu, Clermont-Ferrand ; 31 Av du Bois - Chatenay Malabry, France. email: Cette adresse email est protégée contre les robots des spammeurs, vous devez activer Javascript pour la voir.

(2) Association "Positifs", 147 chemin de la futaie, 83550 Vidauban, email: Cette adresse email est protégée contre les robots des spammeurs, vous devez activer Javascript pour la voir.

 

 

During the Influenza H1N1 pandemic, we found in Influenza virus A H1N1 Japan Hemagglutinin (HA1) 246-YFWKLV-251 the active site loop 39-YFWKLA-44 of the scorpion toxin AaHIT4 (Tran GMK, ISHEID Conf, Toulon, France, 2010: 0291 . www.Positifs.org), with the surprising discovery of a RETRO-INVERSO lecture (from COOH- to NH2-terminus) of Influenza virus HA2 466-VKEYL-462 (= HA2 122-118) matching with the crucial NH2-terminus active site of scorpion 1-VKEgYL-6 which induces broadly cross-reactive neutralising antibodies (Devaux C, 1996). We developped further this short retro-inverso lecture and found a complete scorpion alpha-toxin in the highly pathogenic Influenza virus H5N1 Vietnam 1203/2004 HA2 : Influenzavirus(retro-inverso)126-LQLRVKD-Y-LNKVNSD- -HFD-LT  R- ENEMLV-100

Scorpion  Bot9/AaH2/CsE1   -4 -AEIKVKDgYIVNKVNSDgcKYDcL(L,K)gENEFCL- 26

Influenza virus A H5N1                                78-ENLNK K M ED-GFLDV W TY- NA-96

Scorpion  Bot3/AaHP985                               24-EECNK(K,L)gDsGYCD(I,W)TYgDA-44

Influenza virus A                  45-IDgVPNKVNSI-55                     62-QFE(V,A)GR-EF-70

Scorpion  Bot2/AaH2/LqqV  49-ID-LPDKVRTI-58   Bot2/BotXI  58-RI EV AGRcHF-65

All the scorpion active site residues K2,     Y5,     V10,   Y14,  W38 & G61-R62 (AaH2

numbering) matched with Influenza K121, Y119, V115, F110, W92 & G67-R68.

This was very surprising, because Influenza HA2 (45-126) has no cysteine. Many scorpion cysteines (C16, C26, C36) were matched with Influenza Leucines (L108, L80, L89) or gapped (C12, C63). In conclusion, avian Influenza virus A H5N1 HA2 contains a complete scorpion alpha-toxin, but devoid of any cysteine core structure; this means that its receptor is a sodium Na+ voltage-gated channel and consequently Influenza virus can be inhibited by Na+ channel modifiers (vitamin B1, vegetal fatty acid omega-3, antiarythmics, local anaesthetics (procaïne), eugenol, antimalarials (quinine), antiepileptics). Conversely, fatty acid omega-6 are deleterious. For Influenza vaccine, the epitope mimicking the scorpion NH2-terminus seems crucial. This data points to the importance of RETRO-INVERSO lecture (for instance, the RGD adhesion motif) in deciphering protein function. Three homologies of H5N1 with platelet Integrin ITGB3, disintegrin ITGA2b and plasminogen activator explain the hemorrhagic character of avian Influenza.

 

Mise à jour le Samedi, 04 Novembre 2017 17:24
 


Page 1 sur 14